PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C010904P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 250aa    MW: 26001.5 Da    PI: 8.1194
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C010904P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.5e-382886462
          zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    + l+cprCds ntkfCyynny+lsqPr+fCk+CrryWt+GG+lr+vPvGgg+rkn k+s
  MELO3C010904P1 28 DPLPCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTHGGTLRDVPVGGGSRKNSKRS 86
                    6789***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-332984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3763084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-223484IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MPSESSNRNN SRPQPQHTMG FPPPPQSDPL PCPRCDSLNT KFCYYNNYNL SQPRHFCKSC  60
RRYWTHGGTL RDVPVGGGSR KNSKRSRYHN INNTPSSVSA SSSTSVSSST SASSSSSVSL  120
LPTANALNND INDTIPPPGT FTSLLSSQAS GFLALGGYTS GSGSGHAPAA FDDMGFALGR  180
GLWGTACPYP EVGDLVGSYA AGGAPETSSS GYNTWQMNAT DGGGNGGVVD GDLLGWPDLA  240
ISMQGKSMK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444659.10.0PREDICTED: dof zinc finger protein DOF1.6-like
TrEMBLA0A0A0LKY91e-133A0A0A0LKY9_CUCSA; Uncharacterized protein
STRINGGLYMA02G06970.24e-63(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.13e-35OBF binding protein 1